SUPERFAMILY 1.73 HMM library and genome assignments server

  Home > Genomes > Escherichia coli K-12 subMG1655 > gi|49176035|ref|YP_025295.1|

Domain assignment for gi|49176035|ref|YP_025295.1| from Escherichia coli K-12 subMG1655

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Protein sequence

External link(s) gi|49176035|ref|YP_025295.1|
Sequence length 50
Comment toxic polypeptide, small [Escherichia coli str. K-12 substr. MG1655]
Sequence 
MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK
Download sequence
Identical sequences B1IYM6 B1X5X7 B2N8N6 B3XD95 B7UKM5 P77091
gi|260853832|ref|YP_003227723.1| gi|254160661|ref|YP_003043769.1| gi|215485625|ref|YP_002328056.1| gi|238899859|ref|YP_002925655.1| gi|170080161|ref|YP_001729481.1| gi|170080262|ref|YP_001729582.1| gi|253774437|ref|YP_003037268.1| gi|89107447|ref|AP_001227.1| gi|170021061|ref|YP_001726015.1| gi|251784083|ref|YP_002998387.1| gi|260866730|ref|YP_003233132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@mrc-lmb.cam.ac.uk or use the feedback form.

© Copyright 2001-2010 The Medical Research Council and the SUPERFAMILY authors; Derek Wilson, Martin Madera and Julian Gough.